SRR Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: SRR Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9325
• Hersteller Artikelnummer: A9325
• Alternativnummer: ABB-A9325-100UL,ABB-A9325-20UL,ABB-A9325-1000UL,ABB-A9325-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ILV1, ISO1, SRR

Produktbeschreibung

Enables several functions, including L-serine ammonia-lyase activity, PDZ domain binding activity, and anion binding activity. Involved in pyruvate biosynthetic process, response to lipopolysaccharide, and serine family amino acid metabolic process. Located in cytoplasm and neuronal cell body.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 37kDa
• NCBI: 63826
• UniProt: Q9GZT4
• Reinheit: Affinity purification
• Sequenz: MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDL
• Target-Kategorie: SRR
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease.

Bilder

Western blot analysis of various lysates using SRR Rabbit pAb (A9325) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.