SRR Rabbit pAb, Unconjugated

Product Overview

• Article Name: SRR Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9325
• Supplier Catalog Number: A9325
• Alternative Catalog Number: ABB-A9325-100UL,ABB-A9325-20UL,ABB-A9325-1000UL,ABB-A9325-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ILV1, ISO1, SRR

Product Description

Enables several functions, including L-serine ammonia-lyase activity, PDZ domain binding activity, and anion binding activity. Involved in pyruvate biosynthetic process, response to lipopolysaccharide, and serine family amino acid metabolic process. Located in cytoplasm and neuronal cell body.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 37kDa
• NCBI: 63826
• UniProt: Q9GZT4
• Purity: Affinity purification
• Sequence: MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDL
• Target: SRR
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease.

Images

Western blot analysis of various lysates using SRR Rabbit pAb (A9325) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.