LINGO1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: LINGO1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9369
• Hersteller Artikelnummer: A9369
• Alternativnummer: ABB-A9369-100UL,ABB-A9369-20UL,ABB-A9369-1000UL,ABB-A9369-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: LERN1, MRT64, LRRN6A, UNQ201, LINGO1

Produktbeschreibung

Predicted to enable epidermal growth factor receptor binding activity. Predicted to act upstream of or within generation of neurons and protein kinase B signaling. Predicted to be located in plasma membrane. Predicted to be active in extracellular matrix and extracellular space. Implicated in autosomal recessive non-syndromic intellectual disability and glaucoma.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 70kDa
• NCBI: 84894
• UniProt: Q96FE5
• Reinheit: Affinity purification
• Sequenz: CPPRCECSAQDRAVLCHRKRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYSFKRLYR
• Target-Kategorie: LINGO1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: G protein signaling,G-Protein-Coupled ReceptorsGPCR,Cell Biology Developmental Biology,Neuroscience.

Bilder

Western blot analysis of various lysates using LINGO1 Rabbit pAb (A9369) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.