LINGO1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: LINGO1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9369
• Supplier Catalog Number: A9369
• Alternative Catalog Number: ABB-A9369-100UL,ABB-A9369-20UL,ABB-A9369-1000UL,ABB-A9369-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: LERN1, MRT64, LRRN6A, UNQ201, LINGO1

Product Description

Predicted to enable epidermal growth factor receptor binding activity. Predicted to act upstream of or within generation of neurons and protein kinase B signaling. Predicted to be located in plasma membrane. Predicted to be active in extracellular matrix and extracellular space. Implicated in autosomal recessive non-syndromic intellectual disability and glaucoma.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 70kDa
• NCBI: 84894
• UniProt: Q96FE5
• Purity: Affinity purification
• Sequence: CPPRCECSAQDRAVLCHRKRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYSFKRLYR
• Target: LINGO1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: G protein signaling,G-Protein-Coupled ReceptorsGPCR,Cell Biology Developmental Biology,Neuroscience.

Images

Western blot analysis of various lysates using LINGO1 Rabbit pAb (A9369) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.