EGFL7 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: EGFL7 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9376
• Hersteller Artikelnummer: A9376
• Alternativnummer: ABB-A9376-100UL,ABB-A9376-20UL,ABB-A9376-1000UL,ABB-A9376-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: NEU1, ZNEU1, VE-STATIN, EGFL7

Produktbeschreibung

This gene encodes a secreted endothelial cell protein that contains two epidermal growth factor-like domains. The encoded protein may play a role in regulating vasculogenesis. This protein may be involved in the growth and proliferation of tumor cells. Alternate splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 30kDa
• NCBI: 51162
• UniProt: Q9UHF1
• Reinheit: Affinity purification
• Sequenz: YRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPG
• Target-Kategorie: EGFL7
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat, ResearchArea: Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Cardiovascular.

Bilder

Western blot analysis of various lysates using EGFL7 Rabbit pAb (A9376) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.