EGFL7 Rabbit pAb, Unconjugated

Product Overview

• Article Name: EGFL7 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9376
• Supplier Catalog Number: A9376
• Alternative Catalog Number: ABB-A9376-100UL,ABB-A9376-20UL,ABB-A9376-1000UL,ABB-A9376-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NEU1, ZNEU1, VE-STATIN, EGFL7

Product Description

This gene encodes a secreted endothelial cell protein that contains two epidermal growth factor-like domains. The encoded protein may play a role in regulating vasculogenesis. This protein may be involved in the growth and proliferation of tumor cells. Alternate splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 30kDa
• NCBI: 51162
• UniProt: Q9UHF1
• Purity: Affinity purification
• Sequence: YRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPG
• Target: EGFL7
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat, ResearchArea: Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Cardiovascular.

Images

Western blot analysis of various lysates using EGFL7 Rabbit pAb (A9376) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.