NFIX Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: NFIX Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9390
• Hersteller Artikelnummer: A9390
• Alternativnummer: ABB-A9390-100UL,ABB-A9390-20UL,ABB-A9390-500UL,ABB-A9390-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CTF, NF1A, MALNS, NF1-X, MRSHSS, NF-I/X, SOTOS2, NFIX

Produktbeschreibung

The protein encoded by this gene is a transcription factor that binds the palindromic sequence 5-TTGGCNNNNNGCCAA-3 in viral and cellular promoters. The encoded protein can also stimulate adenovirus replication in vitro. Three transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 55kDa
• NCBI: 4784
• UniProt: Q14938
• Reinheit: Affinity purification
• Sequenz: AYFVHTPESGQSDSSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRVSQTPVATASGPNFSLADLESPSYYNINQVT
• Target-Kategorie: NFIX
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Neuroscience.

Bilder

Western blot analysis of lysates from A-549 cells, using NFIX Rabbit pAb (A9390) at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.