NFIX Rabbit pAb, Unconjugated

Product Overview

• Article Name: NFIX Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9390
• Supplier Catalog Number: A9390
• Alternative Catalog Number: ABB-A9390-100UL,ABB-A9390-20UL,ABB-A9390-500UL,ABB-A9390-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CTF, NF1A, MALNS, NF1-X, MRSHSS, NF-I/X, SOTOS2, NFIX

Product Description

The protein encoded by this gene is a transcription factor that binds the palindromic sequence 5-TTGGCNNNNNGCCAA-3 in viral and cellular promoters. The encoded protein can also stimulate adenovirus replication in vitro. Three transcript variants encoding different isoforms have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 55kDa
• NCBI: 4784
• UniProt: Q14938
• Purity: Affinity purification
• Sequence: AYFVHTPESGQSDSSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRVSQTPVATASGPNFSLADLESPSYYNINQVT
• Target: NFIX
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Neuroscience.

Images

Western blot analysis of lysates from A-549 cells, using NFIX Rabbit pAb (A9390) at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.