HECTD1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: HECTD1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9433
• Hersteller Artikelnummer: A9433
• Alternativnummer: ABB-A9433-20UL,ABB-A9433-100UL,ABB-A9433-1000UL,ABB-A9433-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: EULIR, HECTD1

Produktbeschreibung

Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in anatomical structure development, positive regulation of proteasomal ubiquitin-dependent protein catabolic process, and protein K63-linked ubiquitination. Predicted to act upstream of or within several processes, including animal organ development, negative regulation of protein localization to plasma membrane, and protein autoubiquitination.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 289kDa
• NCBI: 25831
• UniProt: Q9ULT8
• Reinheit: Affinity purification
• Sequenz: PGFLRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPSVNTCVHYLKLPEYSSEEIMRERLLAATMEKGFHLN
• Target-Kategorie: HECTD1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human, ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Cell Cycle,Ubiquitin.

Bilder

Western blot analysis of various lysates using HECTD1 Rabbit pAb (A9433) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.