HECTD1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: HECTD1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9433
• Supplier Catalog Number: A9433
• Alternative Catalog Number: ABB-A9433-20UL,ABB-A9433-100UL,ABB-A9433-1000UL,ABB-A9433-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: EULIR, HECTD1

Product Description

Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in anatomical structure development, positive regulation of proteasomal ubiquitin-dependent protein catabolic process, and protein K63-linked ubiquitination. Predicted to act upstream of or within several processes, including animal organ development, negative regulation of protein localization to plasma membrane, and protein autoubiquitination.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 289kDa
• NCBI: 25831
• UniProt: Q9ULT8
• Purity: Affinity purification
• Sequence: PGFLRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPSVNTCVHYLKLPEYSSEEIMRERLLAATMEKGFHLN
• Target: HECTD1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human, ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Cell Cycle,Ubiquitin.

Images

Western blot analysis of various lysates using HECTD1 Rabbit pAb (A9433) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.