TNPO1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: TNPO1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9435
• Hersteller Artikelnummer: A9435
• Alternativnummer: ABB-A9435-100UL,ABB-A9435-20UL,ABB-A9435-1000UL,ABB-A9435-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MIP, TRN, IPO2, MIP1, KPNB2, TNPO1

Produktbeschreibung

This gene encodes the beta subunit of the karyopherin receptor complex which interacts with nuclear localization signals to target nuclear proteins to the nucleus. The karyopherin receptor complex is a heterodimer of an alpha subunit which recognizes the nuclear localization signal and a beta subunit which docks the complex at nucleoporins. Alternate splicing of this gene results in several transcript variants encoding different proteins.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 102kDa
• NCBI: 3842
• UniProt: Q92973
• Reinheit: Affinity purification
• Sequenz: CPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKE
• Target-Kategorie: TNPO1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:200 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction.

Bilder

Western blot analysis of various lysates using TNPO1 Rabbit pAb (A9435) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 1s.