TNPO1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: TNPO1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9435
• Supplier Catalog Number: A9435
• Alternative Catalog Number: ABB-A9435-100UL,ABB-A9435-20UL,ABB-A9435-1000UL,ABB-A9435-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MIP, TRN, IPO2, MIP1, KPNB2, TNPO1

Product Description

This gene encodes the beta subunit of the karyopherin receptor complex which interacts with nuclear localization signals to target nuclear proteins to the nucleus. The karyopherin receptor complex is a heterodimer of an alpha subunit which recognizes the nuclear localization signal and a beta subunit which docks the complex at nucleoporins. Alternate splicing of this gene results in several transcript variants encoding different proteins.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 102kDa
• NCBI: 3842
• UniProt: Q92973
• Purity: Affinity purification
• Sequence: CPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKE
• Target: TNPO1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:200 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction.

Images

Western blot analysis of various lysates using TNPO1 Rabbit pAb (A9435) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 1s.