ITIH3 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: ITIH3 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9459
• Hersteller Artikelnummer: A9459
• Alternativnummer: ABB-A9459-20UL,ABB-A9459-100UL,ABB-A9459-1000UL,ABB-A9459-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: H3P, SHAP, ITI-HC3, ITIH3

Produktbeschreibung

This gene encodes the heavy chain subunit of the pre-alpha-trypsin inhibitor complex. This complex may stabilize the extracellular matrix through its ability to bind hyaluronic acid. Polymorphisms of this gene may be associated with increased risk for schizophrenia and major depressive disorder. This gene is present in an inter-alpha-trypsin inhibitor family gene cluster on chromosome 3.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 100kDa
• NCBI: 3699
• UniProt: Q06033
• Reinheit: Affinity purification
• Sequenz: LPEGVANGIEVYSTKINSKVTSRFAHNVVTMRAVNRADTAKEVSFDVELPKTAFITNFTLTIDGVTYPGNVKEKEVAKKQYEKAVSQGKTAGLVKASGRKLEKFTVSVNVAAGSKVTFELTYEELLKRHKGKYEMYLKVQPKQLVK
• Target-Kategorie: ITIH3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat

Bilder

Western blot analysis of various lysates using ITIH3 Rabbit pAb (A9459) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.