ITIH3 Rabbit pAb, Unconjugated

Product Overview

• Article Name: ITIH3 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9459
• Supplier Catalog Number: A9459
• Alternative Catalog Number: ABB-A9459-20UL,ABB-A9459-100UL,ABB-A9459-1000UL,ABB-A9459-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: H3P, SHAP, ITI-HC3, ITIH3

Product Description

This gene encodes the heavy chain subunit of the pre-alpha-trypsin inhibitor complex. This complex may stabilize the extracellular matrix through its ability to bind hyaluronic acid. Polymorphisms of this gene may be associated with increased risk for schizophrenia and major depressive disorder. This gene is present in an inter-alpha-trypsin inhibitor family gene cluster on chromosome 3.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 100kDa
• NCBI: 3699
• UniProt: Q06033
• Purity: Affinity purification
• Sequence: LPEGVANGIEVYSTKINSKVTSRFAHNVVTMRAVNRADTAKEVSFDVELPKTAFITNFTLTIDGVTYPGNVKEKEVAKKQYEKAVSQGKTAGLVKASGRKLEKFTVSVNVAAGSKVTFELTYEELLKRHKGKYEMYLKVQPKQLVK
• Target: ITIH3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat

Images

Western blot analysis of various lysates using ITIH3 Rabbit pAb (A9459) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.