USP39 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: USP39 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9582
• Hersteller Artikelnummer: A9582
• Alternativnummer: ABB-A9582-100UL,ABB-A9582-20UL,ABB-A9582-500UL,ABB-A9582-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: 65K, SAD1, CGI-21, HSPC332, SNRNP65, USP39

Produktbeschreibung

Predicted to enable thiol-dependent deubiquitinase and zinc ion binding activity. Involved in spliceosomal complex assembly. Located in nucleoplasm. Part of U4/U6 x U5 tri-snRNP complex.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 65kDa
• NCBI: 10713
• UniProt: Q53GS9
• Reinheit: Affinity purification
• Sequenz: GTKKKKKTIVTDVFQGSMRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPLYKDEKEQLIIPQVPLFNILAKFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQGA
• Target-Kategorie: USP39
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin.

Bilder

Western blot analysis of various lysates using USP39 Rabbit pAb (A9582) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.