USP39 Rabbit pAb, Unconjugated

Product Overview

• Article Name: USP39 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9582
• Supplier Catalog Number: A9582
• Alternative Catalog Number: ABB-A9582-100UL,ABB-A9582-20UL,ABB-A9582-500UL,ABB-A9582-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: 65K, SAD1, CGI-21, HSPC332, SNRNP65, USP39

Product Description

Predicted to enable thiol-dependent deubiquitinase and zinc ion binding activity. Involved in spliceosomal complex assembly. Located in nucleoplasm. Part of U4/U6 x U5 tri-snRNP complex.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 65kDa
• NCBI: 10713
• UniProt: Q53GS9
• Purity: Affinity purification
• Sequence: GTKKKKKTIVTDVFQGSMRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPLYKDEKEQLIIPQVPLFNILAKFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQGA
• Target: USP39
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin.

Images

Western blot analysis of various lysates using USP39 Rabbit pAb (A9582) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.