ST8SIA1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: ST8SIA1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9648
• Hersteller Artikelnummer: A9648
• Alternativnummer: ABB-A9648-20UL,ABB-A9648-100UL,ABB-A9648-1000UL,ABB-A9648-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: GD3S, SIAT8, SIAT8A, SIAT8-A, ST8SiaI, ST8SIA1

Produktbeschreibung

Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. The encoded protein may be found in the Golgi apparatus and is a member of glycosyltransferase family 29. Alternatively spliced transcript variants have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 41kDa
• NCBI: 6489
• UniProt: Q92185
• Reinheit: Affinity purification
• Sequenz: YRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHA
• Target-Kategorie: ST8SIA1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:2000 - 1:9000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse, ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Endocrine Metabolism.

Bilder

Western blot analysis of lysates from Mouse kidney, using ST8SIA1 Rabbit pAb (A9648) at 1:8000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.