ST8SIA1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: ST8SIA1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9648
• Supplier Catalog Number: A9648
• Alternative Catalog Number: ABB-A9648-20UL,ABB-A9648-100UL,ABB-A9648-1000UL,ABB-A9648-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: GD3S, SIAT8, SIAT8A, SIAT8-A, ST8SiaI, ST8SIA1

Product Description

Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. The encoded protein may be found in the Golgi apparatus and is a member of glycosyltransferase family 29. Alternatively spliced transcript variants have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 41kDa
• NCBI: 6489
• UniProt: Q92185
• Purity: Affinity purification
• Sequence: YRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHA
• Target: ST8SIA1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:2000 - 1:9000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse, ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Endocrine Metabolism.

Images

Western blot analysis of lysates from Mouse kidney, using ST8SIA1 Rabbit pAb (A9648) at 1:8000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.