FER Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: FER Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9687
• Hersteller Artikelnummer: A9687
• Alternativnummer: ABB-A9687-100UL,ABB-A9687-20UL,ABB-A9687-1000UL,ABB-A9687-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: TYK3, PPP1R74, p94-Fer, FER

Produktbeschreibung

The protein encoded by this gene is a member of the FPS/FES family of non-transmembrane receptor tyrosine kinases. It regulates cell-cell adhesion and mediates signaling from the cell surface to the cytoskeleton via growth factor receptors. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome X.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 95kDa
• NCBI: 2241
• UniProt: P16591
• Reinheit: Affinity purification
• Sequenz: YDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNLTAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKSALGSSALSDMISI
• Target-Kategorie: FER
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology,Cell Cycle,Wnt -Catenin Signaling Pathway.

Bilder

Western blot analysis of various lysates using FER Rabbit pAb (A9687) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Basic Kit (RM00020)._Exposure time: 10s.