FER Rabbit pAb, Unconjugated

Product Overview

• Article Name: FER Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9687
• Supplier Catalog Number: A9687
• Alternative Catalog Number: ABB-A9687-100UL,ABB-A9687-20UL,ABB-A9687-1000UL,ABB-A9687-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: TYK3, PPP1R74, p94-Fer, FER

Product Description

The protein encoded by this gene is a member of the FPS/FES family of non-transmembrane receptor tyrosine kinases. It regulates cell-cell adhesion and mediates signaling from the cell surface to the cytoskeleton via growth factor receptors. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome X.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 95kDa
• NCBI: 2241
• UniProt: P16591
• Purity: Affinity purification
• Sequence: YDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNLTAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKSALGSSALSDMISI
• Target: FER
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology,Cell Cycle,Wnt -Catenin Signaling Pathway.

Images

Western blot analysis of various lysates using FER Rabbit pAb (A9687) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Basic Kit (RM00020)._Exposure time: 10s.