CHERP Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: CHERP Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9702
• Hersteller Artikelnummer: A9702
• Alternativnummer: ABB-A9702-100UL,ABB-A9702-20UL,ABB-A9702-500UL,ABB-A9702-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: SRA1, DAN16, SCAF6, CHERP

Produktbeschreibung

Enables transmembrane transporter binding activity. Involved in positive regulation of calcineurin-NFAT signaling cascade and release of sequestered calcium ion into cytosol. Acts upstream of or within cellular calcium ion homeostasis and negative regulation of cell population proliferation. Located in perinuclear region of cytoplasm.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 104kDa
• NCBI: 10523
• UniProt: Q8IWX8
• Reinheit: Affinity purification
• Sequenz: LPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKRNSGPSRSRSRSKSRGRSS
• Target-Kategorie: CHERP
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Neuroscience,Calcium Signaling.

Bilder

Western blot analysis of various lysates using CHERP Rabbit pAb (A9702) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.