CHERP Rabbit pAb, Unconjugated

Product Overview

• Article Name: CHERP Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9702
• Supplier Catalog Number: A9702
• Alternative Catalog Number: ABB-A9702-100UL,ABB-A9702-20UL,ABB-A9702-500UL,ABB-A9702-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: SRA1, DAN16, SCAF6, CHERP

Product Description

Enables transmembrane transporter binding activity. Involved in positive regulation of calcineurin-NFAT signaling cascade and release of sequestered calcium ion into cytosol. Acts upstream of or within cellular calcium ion homeostasis and negative regulation of cell population proliferation. Located in perinuclear region of cytoplasm.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 104kDa
• NCBI: 10523
• UniProt: Q8IWX8
• Purity: Affinity purification
• Sequence: LPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKRNSGPSRSRSRSKSRGRSS
• Target: CHERP
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Neuroscience,Calcium Signaling.

Images

Western blot analysis of various lysates using CHERP Rabbit pAb (A9702) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.