NFYC Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: NFYC Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9832
• Hersteller Artikelnummer: A9832
• Alternativnummer: ABB-A9832-20UL,ABB-A9832-100UL,ABB-A9832-1000UL,ABB-A9832-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HSM, CBFC, HAP5, CBF-C, NF-YC, H1TF2A, NFYC

Produktbeschreibung

This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 50kDa
• NCBI: 4802
• UniProt: Q13952
• Reinheit: Affinity purification
• Sequenz: MEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR
• Target-Kategorie: NFYC
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors.

Bilder

Western blot analysis of lysates from Rat thymus, using NFYC Rabbit pAb (A9832) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.