NFYC Rabbit pAb, Unconjugated

Product Overview

• Article Name: NFYC Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9832
• Supplier Catalog Number: A9832
• Alternative Catalog Number: ABB-A9832-20UL,ABB-A9832-100UL,ABB-A9832-1000UL,ABB-A9832-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HSM, CBFC, HAP5, CBF-C, NF-YC, H1TF2A, NFYC

Product Description

This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 50kDa
• NCBI: 4802
• UniProt: Q13952
• Purity: Affinity purification
• Sequence: MEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR
• Target: NFYC
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors.

Images

Western blot analysis of lysates from Rat thymus, using NFYC Rabbit pAb (A9832) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.