NFYC Rabbit pAb, Unconjugated

Catalog Number: ABB-A9832
Article Name: NFYC Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A9832
Supplier Catalog Number: A9832
Alternative Catalog Number: ABB-A9832-20UL,ABB-A9832-100UL,ABB-A9832-1000UL,ABB-A9832-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HSM, CBFC, HAP5, CBF-C, NF-YC, H1TF2A, NFYC
This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 4802
UniProt: Q13952
Purity: Affinity purification
Sequence: MEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR
Target: NFYC
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors.
Western blot analysis of lysates from Rat thymus, using NFYC Rabbit pAb (A9832) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.