KCNE2 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A9859
Artikelname: KCNE2 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A9859
Hersteller Artikelnummer: A9859
Alternativnummer: ABB-A9859-20UL,ABB-A9859-100UL,ABB-A9859-1000UL,ABB-A9859-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: LQT5, LQT6, ATFB4, MIRP1, KCNE2
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia.
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 9992
UniProt: Q9Y6J6
Reinheit: Affinity purification
Sequenz: MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQI
Target-Kategorie: KCNE2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Neuroscience,Cardiovascular,Heart,Cardiac arrhythmias.
Western blot analysis of lysates from U-251MG cells, using KCNE2 Rabbit pAb (A9859) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.