KCNE2 Rabbit pAb, Unconjugated

Catalog Number: ABB-A9859
Article Name: KCNE2 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A9859
Supplier Catalog Number: A9859
Alternative Catalog Number: ABB-A9859-20UL,ABB-A9859-100UL,ABB-A9859-1000UL,ABB-A9859-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LQT5, LQT6, ATFB4, MIRP1, KCNE2
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia.
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 9992
UniProt: Q9Y6J6
Purity: Affinity purification
Sequence: MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQI
Target: KCNE2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Neuroscience,Cardiovascular,Heart,Cardiac arrhythmias.
Western blot analysis of lysates from U-251MG cells, using KCNE2 Rabbit pAb (A9859) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.