UQCRQ Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: UQCRQ Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9872
• Hersteller Artikelnummer: A9872
• Alternativnummer: ABB-A9872-20UL,ABB-A9872-100UL,ABB-A9872-1000UL,ABB-A9872-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: QPC, QCR8, QP-C, UQCR7, MC3DN4, UQCRQ

Produktbeschreibung

This gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 10kDa
• NCBI: 27089
• UniProt: O14949
• Reinheit: Affinity purification
• Sequenz: MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK
• Target-Kategorie: UQCRQ
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Oxidative phosphorylation,Neuroscience,Neurodegenerative Diseases.

Bilder

Western blot analysis of various lysates using UQCRQ Rabbit pAb (A9872) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.