UQCRQ Rabbit pAb, Unconjugated

Product Overview

• Article Name: UQCRQ Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9872
• Supplier Catalog Number: A9872
• Alternative Catalog Number: ABB-A9872-20UL,ABB-A9872-100UL,ABB-A9872-1000UL,ABB-A9872-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: QPC, QCR8, QP-C, UQCR7, MC3DN4, UQCRQ

Product Description

This gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 10kDa
• NCBI: 27089
• UniProt: O14949
• Purity: Affinity purification
• Sequence: MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK
• Target: UQCRQ
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Oxidative phosphorylation,Neuroscience,Neurodegenerative Diseases.

Images

Western blot analysis of various lysates using UQCRQ Rabbit pAb (A9872) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.