RBM15B Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: RBM15B Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9873
• Hersteller Artikelnummer: A9873
• Alternativnummer: ABB-A9873-20UL,ABB-A9873-100UL,ABB-A9873-500UL,ABB-A9873-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: OTT3, HsOTT3, HUMAGCGB, RBM15B

Produktbeschreibung

Members of the SPEN (Split-end) family of proteins, including RBM15B, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components (Hiriart et al., 2005 [PubMed 16129689]).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 97kDa
• NCBI: 29890
• UniProt: Q8NDT2
• Reinheit: Affinity purification
• Sequenz: DRDRTFLEGDWTSPSKSSDRRNSLEGYSRSVRSRSGERWGADGDRGLPKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGSGQQSERGSDRTPERSRKENHSSEGTKESSSNSLSNSRHGAEERGHHHHHHEAADSSHGKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQL
• Target-Kategorie: RBM15B
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction.

Bilder

Western blot analysis of various lysates using RBM15B Rabbit pAb (A9873) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.