RBM15B Rabbit pAb, Unconjugated

Product Overview

• Article Name: RBM15B Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9873
• Supplier Catalog Number: A9873
• Alternative Catalog Number: ABB-A9873-20UL,ABB-A9873-100UL,ABB-A9873-500UL,ABB-A9873-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: OTT3, HsOTT3, HUMAGCGB, RBM15B

Product Description

Members of the SPEN (Split-end) family of proteins, including RBM15B, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components (Hiriart et al., 2005 [PubMed 16129689]).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 97kDa
• NCBI: 29890
• UniProt: Q8NDT2
• Purity: Affinity purification
• Sequence: DRDRTFLEGDWTSPSKSSDRRNSLEGYSRSVRSRSGERWGADGDRGLPKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGSGQQSERGSDRTPERSRKENHSSEGTKESSSNSLSNSRHGAEERGHHHHHHEAADSSHGKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQL
• Target: RBM15B
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction.

Images

Western blot analysis of various lysates using RBM15B Rabbit pAb (A9873) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.