ROBO4 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: ROBO4 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9876
• Hersteller Artikelnummer: A9876
• Alternativnummer: ABB-A9876-100UL,ABB-A9876-20UL,ABB-A9876-500UL,ABB-A9876-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MRB, AOVD3, ECSM4, ROBO4

Produktbeschreibung

Predicted to enable cell-cell adhesion mediator activity. Involved in angiogenesis and establishment of endothelial barrier. Located in extracellular exosome. Implicated in aortic valve disease 3.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 107kDa
• NCBI: 54538
• UniProt: Q8WZ75
• Reinheit: Affinity purification
• Sequenz: GVGPKGGVLLCPPRPCLTPTPSEGSLANGWGSASEDNAASARASLVSSSDGSFLADAHFARALAVAVDSFGFGLEPREADCVFIDASSPPSPRDEIFLTPNLSLPLWEWRPDWLEDMEVSHTQRLGRGMPPWPPDSQISSQRSQLHCRMPKAGASPVDYS
• Target-Kategorie: ROBO4
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human, ResearchArea: Cancer,Invasion and Metastasis,Cell Biology Developmental Biology,Extracellular Matrix,Neuroscience,Cardiovascular,Angiogenesis.

Bilder

Western blot analysis of various lysates using ROBO4 Rabbit pAb (A9876) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.