ROBO4 Rabbit pAb, Unconjugated

Product Overview

• Article Name: ROBO4 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9876
• Supplier Catalog Number: A9876
• Alternative Catalog Number: ABB-A9876-100UL,ABB-A9876-20UL,ABB-A9876-500UL,ABB-A9876-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MRB, AOVD3, ECSM4, ROBO4

Product Description

Predicted to enable cell-cell adhesion mediator activity. Involved in angiogenesis and establishment of endothelial barrier. Located in extracellular exosome. Implicated in aortic valve disease 3.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 107kDa
• NCBI: 54538
• UniProt: Q8WZ75
• Purity: Affinity purification
• Sequence: GVGPKGGVLLCPPRPCLTPTPSEGSLANGWGSASEDNAASARASLVSSSDGSFLADAHFARALAVAVDSFGFGLEPREADCVFIDASSPPSPRDEIFLTPNLSLPLWEWRPDWLEDMEVSHTQRLGRGMPPWPPDSQISSQRSQLHCRMPKAGASPVDYS
• Target: ROBO4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human, ResearchArea: Cancer,Invasion and Metastasis,Cell Biology Developmental Biology,Extracellular Matrix,Neuroscience,Cardiovascular,Angiogenesis.

Images

Western blot analysis of various lysates using ROBO4 Rabbit pAb (A9876) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.