ANKH Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: ANKH Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9881
• Hersteller Artikelnummer: A9881
• Alternativnummer: ABB-A9881-100UL,ABB-A9881-20UL,ABB-A9881-500UL,ABB-A9881-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ANK, CMDJ, HANK, MANK, CCAL2, CPPDD, SLC62A1, ANKH

Produktbeschreibung

This gene encodes a multipass transmembrane protein that is expressed in joints and other tissues and controls pyrophosphate levels in cultured cells. Progressive ankylosis-mediated control of pyrophosphate levels has been suggested as a possible mechanism regulating tissue calcification and susceptibility to arthritis in higher animals. Mutations in this gene have been associated with autosomal dominant craniometaphyseal dysplasia.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 54kDa
• NCBI: 56172
• UniProt: Q9HCJ1
• Reinheit: Affinity purification
• Sequenz: LGYYKNIHDIIPDRSGPELGGDATIRKMLSFWWPLALILATQRISRPIVNLFVSRDLGGSSAATEAVAILTATYPVGHMPYGWLTEIRAVYPAFDKNNPSNKLVSTSNTVT
• Target-Kategorie: ANKH
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Bone.

Bilder

Western blot analysis of various lysates using ANKH Rabbit pAb (A9881) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.