ANKH Rabbit pAb, Unconjugated

Product Overview

• Article Name: ANKH Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9881
• Supplier Catalog Number: A9881
• Alternative Catalog Number: ABB-A9881-100UL,ABB-A9881-20UL,ABB-A9881-500UL,ABB-A9881-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ANK, CMDJ, HANK, MANK, CCAL2, CPPDD, SLC62A1, ANKH

Product Description

This gene encodes a multipass transmembrane protein that is expressed in joints and other tissues and controls pyrophosphate levels in cultured cells. Progressive ankylosis-mediated control of pyrophosphate levels has been suggested as a possible mechanism regulating tissue calcification and susceptibility to arthritis in higher animals. Mutations in this gene have been associated with autosomal dominant craniometaphyseal dysplasia.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 54kDa
• NCBI: 56172
• UniProt: Q9HCJ1
• Purity: Affinity purification
• Sequence: LGYYKNIHDIIPDRSGPELGGDATIRKMLSFWWPLALILATQRISRPIVNLFVSRDLGGSSAATEAVAILTATYPVGHMPYGWLTEIRAVYPAFDKNNPSNKLVSTSNTVT
• Target: ANKH
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Bone.

Images

Western blot analysis of various lysates using ANKH Rabbit pAb (A9881) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.