POLE4 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: POLE4 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9882
• Hersteller Artikelnummer: A9882
• Alternativnummer: ABB-A9882-20UL,ABB-A9882-100UL,ABB-A9882-1000UL,ABB-A9882-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: p12, YHHQ1, POLE4

Produktbeschreibung

POLE4 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 12kDa
• NCBI: 56655
• UniProt: Q9NR33
• Reinheit: Affinity purification
• Sequenz: MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD
• Target-Kategorie: POLE4
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human

Bilder

Western blot analysis of various lysates using POLE4 Rabbit pAb (A9882) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.