POLE4 Rabbit pAb, Unconjugated

Product Overview

• Article Name: POLE4 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9882
• Supplier Catalog Number: A9882
• Alternative Catalog Number: ABB-A9882-20UL,ABB-A9882-100UL,ABB-A9882-1000UL,ABB-A9882-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: p12, YHHQ1, POLE4

Product Description

POLE4 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 12kDa
• NCBI: 56655
• UniProt: Q9NR33
• Purity: Affinity purification
• Sequence: MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD
• Target: POLE4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human

Images

Western blot analysis of various lysates using POLE4 Rabbit pAb (A9882) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.