HSP20/HSPB6 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: HSP20/HSPB6 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9887
• Hersteller Artikelnummer: A9887
• Alternativnummer: ABB-A9887-100UL,ABB-A9887-20UL,ABB-A9887-500UL,ABB-A9887-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HEL55, Hsp20, PPP1R91, HSP20/HSPB6

Produktbeschreibung

This locus encodes a heat shock protein. The encoded protein likely plays a role in smooth muscle relaxation.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 17kDa
• NCBI: 126393
• UniProt: O14558
• Reinheit: Affinity purification
• Sequenz: MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK
• Target-Kategorie: HSPB6
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse, ResearchArea: Apoptosis,Cardiovascular,Heart.

Bilder

Western blot analysis of lysates from mouse lung, using HSP20/HSPB6 Rabbit pAb (A9887) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.