HSP20/HSPB6 Rabbit pAb, Unconjugated

Product Overview

• Article Name: HSP20/HSPB6 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9887
• Supplier Catalog Number: A9887
• Alternative Catalog Number: ABB-A9887-100UL,ABB-A9887-20UL,ABB-A9887-500UL,ABB-A9887-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HEL55, Hsp20, PPP1R91, HSP20/HSPB6

Product Description

This locus encodes a heat shock protein. The encoded protein likely plays a role in smooth muscle relaxation.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 17kDa
• NCBI: 126393
• UniProt: O14558
• Purity: Affinity purification
• Sequence: MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK
• Target: HSPB6
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse, ResearchArea: Apoptosis,Cardiovascular,Heart.

Images

Western blot analysis of lysates from mouse lung, using HSP20/HSPB6 Rabbit pAb (A9887) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.