STRA13 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A9892
Artikelname: STRA13 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A9892
Hersteller Artikelnummer: A9892
Alternativnummer: ABB-A9892-100UL,ABB-A9892-20UL,ABB-A9892-500UL,ABB-A9892-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: D9, MHF2, CENP-X, FAAP10, STRA13
Enables DNA binding activity. Contributes to double-stranded DNA binding activity. Involved in replication fork processing and resolution of meiotic recombination intermediates. Part of FANCM-MHF complex and Fanconi anaemia nuclear complex.
Klonalität: Polyclonal
Molekulargewicht: 9kDa
NCBI: 201254
UniProt: A8MT69
Reinheit: Affinity purification
Sequenz: MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF
Target-Kategorie: CENPX
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human, ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair.
Western blot analysis of lysates from H460 cells, using STRA13 Rabbit pAb (A9892) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.