STRA13 Rabbit pAb, Unconjugated

Product Overview

• Article Name: STRA13 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9892
• Supplier Catalog Number: A9892
• Alternative Catalog Number: ABB-A9892-100UL,ABB-A9892-20UL,ABB-A9892-500UL,ABB-A9892-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: D9, MHF2, CENP-X, FAAP10, STRA13

Product Description

Enables DNA binding activity. Contributes to double-stranded DNA binding activity. Involved in replication fork processing and resolution of meiotic recombination intermediates. Part of FANCM-MHF complex and Fanconi anaemia nuclear complex.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 9kDa
• NCBI: 201254
• UniProt: A8MT69
• Purity: Affinity purification
• Sequence: MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF
• Target: CENPX
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human, ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair.

Images

Western blot analysis of lysates from H460 cells, using STRA13 Rabbit pAb (A9892) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.