CD72 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: CD72 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9930
• Hersteller Artikelnummer: A9930
• Alternativnummer: ABB-A9930-20UL,ABB-A9930-100UL,ABB-A9930-500UL,ABB-A9930-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: LYB2, CD72b, CD72

Produktbeschreibung

Predicted to enable signaling receptor binding activity. Predicted to be involved in cell adhesion. Is integral component of plasma membrane.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 40kDa
• NCBI: 971
• UniProt: P21854
• Reinheit: Affinity purification
• Sequenz: QVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD
• Target-Kategorie: CD72
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors.

Bilder

Western blot analysis of lysates from Daudi cells, using CD72 Rabbit pAb (A9930) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.