CD72 Rabbit pAb, Unconjugated

Product Overview

• Article Name: CD72 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9930
• Supplier Catalog Number: A9930
• Alternative Catalog Number: ABB-A9930-20UL,ABB-A9930-100UL,ABB-A9930-500UL,ABB-A9930-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: LYB2, CD72b, CD72

Product Description

Predicted to enable signaling receptor binding activity. Predicted to be involved in cell adhesion. Is integral component of plasma membrane.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 40kDa
• NCBI: 971
• UniProt: P21854
• Purity: Affinity purification
• Sequence: QVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD
• Target: CD72
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors.

Images

Western blot analysis of lysates from Daudi cells, using CD72 Rabbit pAb (A9930) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.