GABRA5 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A9932
- Bilder (1)
| Artikelname: | GABRA5 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A9932 |
| Hersteller Artikelnummer: | A9932 |
| Alternativnummer: | ABB-A9932-20UL,ABB-A9932-100UL,ABB-A9932-500UL,ABB-A9932-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DEE79, EIEE79, GABRA5 |
| GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. Transcript variants utilizing three different alternative non-coding first exons have been described. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 52kDa |
| NCBI: | 2558 |
| UniProt: | P31644 |
| Reinheit: | Affinity purification |
| Sequenz: | QMPTSSVKDETNDNITIFTRILDGLLDGYDNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPLNNLLASKIWTPDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLEDFPMDAHACPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTSTGEYTIMTAHFHLKRKIGY |
| Target-Kategorie: | GABRA5 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat, ResearchArea: Neuroscience. |
|
|
Western blot analysis of various lysates using GABRA5 Rabbit pAb (A9932) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s. |
Produktgarantie und fachkundiger Support
