GABRA5 Rabbit pAb, Unconjugated

Product Overview

• Article Name: GABRA5 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9932
• Supplier Catalog Number: A9932
• Alternative Catalog Number: ABB-A9932-20UL,ABB-A9932-100UL,ABB-A9932-500UL,ABB-A9932-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: DEE79, EIEE79, GABRA5

Product Description

GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. Transcript variants utilizing three different alternative non-coding first exons have been described.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 52kDa
• NCBI: 2558
• UniProt: P31644
• Purity: Affinity purification
• Sequence: QMPTSSVKDETNDNITIFTRILDGLLDGYDNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPLNNLLASKIWTPDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLEDFPMDAHACPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTSTGEYTIMTAHFHLKRKIGY
• Target: GABRA5
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat, ResearchArea: Neuroscience.

Images

Western blot analysis of various lysates using GABRA5 Rabbit pAb (A9932) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.