MT-CO3 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: MT-CO3 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9939
• Hersteller Artikelnummer: A9939
• Alternativnummer: ABB-A9939-100UL,ABB-A9939-20UL,ABB-A9939-500UL,ABB-A9939-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Mouse
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: COX3, MT-CO3

Produktbeschreibung

Predicted to enable electron transfer activity and oxidoreduction-driven active transmembrane transporter activity. Predicted to be involved in mitochondrial electron transport, cytochrome c to oxygen and respiratory chain complex IV assembly. Located in mitochondrion. Is expressed in several structures, including alimentary system, brain, heart, integumental system, and sensory organ. Human ortholog(s) of this gene implicated in MELAS syndrome. Orthologous to human MT-CO3 (mitochondrially encoded cytochrome c oxidase III).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 29kDa
• NCBI: 17710
• Reinheit: Affinity purification
• Sequenz: MTHQTHAYHMVNPSPWPLTGAFSALLLTSGLVMWFHYNSITLLTLGLLTNILTMYQWWRDVIREGTYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWA
• Target-Kategorie: mt-Co3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Cell Biology & Developmental Biology,Endocrine & Metabolism,Mitochondrial metabolism,Cytochromes,Mitochondrial markers,Oxidative phosphorylation,Lipid Metabolism,Cytochromes,Lipases,Neuroscience,Neurodegenerative Diseases,Cardiovascular,Lipids.

Bilder

Western blot analysis of various lysates using MT-CO3 Rabbit pAb (A9939) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.