MT-CO3 Rabbit pAb, Unconjugated

Product Overview

• Article Name: MT-CO3 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9939
• Supplier Catalog Number: A9939
• Alternative Catalog Number: ABB-A9939-100UL,ABB-A9939-20UL,ABB-A9939-500UL,ABB-A9939-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Mouse
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: COX3, MT-CO3

Product Description

Predicted to enable electron transfer activity and oxidoreduction-driven active transmembrane transporter activity. Predicted to be involved in mitochondrial electron transport, cytochrome c to oxygen and respiratory chain complex IV assembly. Located in mitochondrion. Is expressed in several structures, including alimentary system, brain, heart, integumental system, and sensory organ. Human ortholog(s) of this gene implicated in MELAS syndrome. Orthologous to human MT-CO3 (mitochondrially encoded cytochrome c oxidase III).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 29kDa
• NCBI: 17710
• Purity: Affinity purification
• Sequence: MTHQTHAYHMVNPSPWPLTGAFSALLLTSGLVMWFHYNSITLLTLGLLTNILTMYQWWRDVIREGTYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWA
• Target: mt-Co3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Cell Biology & Developmental Biology,Endocrine & Metabolism,Mitochondrial metabolism,Cytochromes,Mitochondrial markers,Oxidative phosphorylation,Lipid Metabolism,Cytochromes,Lipases,Neuroscience,Neurodegenerative Diseases,Cardiovascular,Lipids.

Images

Western blot analysis of various lysates using MT-CO3 Rabbit pAb (A9939) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.