MT-ND4 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: MT-ND4 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9941
• Hersteller Artikelnummer: A9941
• Alternativnummer: ABB-A9941-20UL,ABB-A9941-100UL,ABB-A9941-1000UL,ABB-A9941-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Mouse
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ND4, MT-ND4

Produktbeschreibung

Predicted to enable NADH dehydrogenase (ubiquinone) activity and ubiquinone binding activity. Predicted to contribute to NADH dehydrogenase activity. Predicted to be involved in several processes, including electron transport coupled proton transport, mitochondrial electron transport, NADH to ubiquinone, and mitochondrial respiratory chain complex I assembly. Located in mitochondrion. Human ortholog(s) of this gene implicated in Leber hereditary optic neuropathy, Parkinsons disease, macular degeneration, and schizophrenia. Orthologous to human MT-ND4 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 4).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 51kDa
• NCBI: 17719
• Reinheit: Affinity purification
• Sequenz: LMASLANLALPPSINLMGELFITMSLFSWSNFTIILMGINIIITGMYSMYMIITTQRGKLTNHMINLQPSHTRELTLMALHMIPLILLTTSPKLITGLTM
• Target-Kategorie: mt-Nd4
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Endocrine & Metabolism,Mitochondrial metabolism,Neuroscience,Neurodegenerative Diseases.

Bilder

Western blot analysis of various lysates using MT-ND4 Rabbit pAb (A9941) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.