MT-ND4 Rabbit pAb, Unconjugated

Product Overview

• Article Name: MT-ND4 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9941
• Supplier Catalog Number: A9941
• Alternative Catalog Number: ABB-A9941-20UL,ABB-A9941-100UL,ABB-A9941-1000UL,ABB-A9941-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Mouse
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ND4, MT-ND4

Product Description

Predicted to enable NADH dehydrogenase (ubiquinone) activity and ubiquinone binding activity. Predicted to contribute to NADH dehydrogenase activity. Predicted to be involved in several processes, including electron transport coupled proton transport, mitochondrial electron transport, NADH to ubiquinone, and mitochondrial respiratory chain complex I assembly. Located in mitochondrion. Human ortholog(s) of this gene implicated in Leber hereditary optic neuropathy, Parkinsons disease, macular degeneration, and schizophrenia. Orthologous to human MT-ND4 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 4).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 51kDa
• NCBI: 17719
• Purity: Affinity purification
• Sequence: LMASLANLALPPSINLMGELFITMSLFSWSNFTIILMGINIIITGMYSMYMIITTQRGKLTNHMINLQPSHTRELTLMALHMIPLILLTTSPKLITGLTM
• Target: mt-Nd4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Endocrine & Metabolism,Mitochondrial metabolism,Neuroscience,Neurodegenerative Diseases.

Images

Western blot analysis of various lysates using MT-ND4 Rabbit pAb (A9941) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.