SERPINB6 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A9944
Artikelname: SERPINB6 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A9944
Hersteller Artikelnummer: A9944
Alternativnummer: ABB-A9944-20UL,ABB-A9944-100UL,ABB-A9944-500UL,ABB-A9944-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CAP, PI6, PTI, PI-6, SPI3, DFNB91, MSTP057, SERPINB6
The protein encoded by this gene is a member of the serpin (serine proteinase inhibitor) superfamily, and ovalbumin(ov)-serpin subfamily. It was originally discovered as a placental thrombin inhibitor. The mouse homolog was found to be expressed in the hair cells of the inner ear. Mutations in this gene are associated with nonsyndromic progressive hearing loss, suggesting that this serpin plays an important role in the inner ear in the protection against leakage of lysosomal content during stress, and that loss of this protection results in cell death and sensorineural hearing loss. Alternatively spliced transcript variants have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 5269
UniProt: P35237
Reinheit: Affinity purification
Sequenz: ENTEERLFKVSKNEEKPVQMMFKQSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKA
Target-Kategorie: SERPINB6
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Ubiquitin.
Western blot analysis of various lysates using SERPINB6 Rabbit pAb (A9944) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.