SERPINB6 Rabbit pAb, Unconjugated

Catalog Number: ABB-A9944
Article Name: SERPINB6 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A9944
Supplier Catalog Number: A9944
Alternative Catalog Number: ABB-A9944-20UL,ABB-A9944-100UL,ABB-A9944-500UL,ABB-A9944-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CAP, PI6, PTI, PI-6, SPI3, DFNB91, MSTP057, SERPINB6
The protein encoded by this gene is a member of the serpin (serine proteinase inhibitor) superfamily, and ovalbumin(ov)-serpin subfamily. It was originally discovered as a placental thrombin inhibitor. The mouse homolog was found to be expressed in the hair cells of the inner ear. Mutations in this gene are associated with nonsyndromic progressive hearing loss, suggesting that this serpin plays an important role in the inner ear in the protection against leakage of lysosomal content during stress, and that loss of this protection results in cell death and sensorineural hearing loss. Alternatively spliced transcript variants have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 5269
UniProt: P35237
Purity: Affinity purification
Sequence: ENTEERLFKVSKNEEKPVQMMFKQSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKA
Target: SERPINB6
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Ubiquitin.
Western blot analysis of various lysates using SERPINB6 Rabbit pAb (A9944) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.